Lineage for d1jckb2 (1jck B:122-239)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717917Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 717918Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries)
  8. 717929Domain d1jckb2: 1jck B:122-239 [37785]
    Other proteins in same PDB: d1jcka1, d1jcka2, d1jckb1, d1jckc1, d1jckc2, d1jckd1

Details for d1jckb2

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen
PDB Compounds: (B:) staphylococcal enterotoxin c3

SCOP Domain Sequences for d1jckb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckb2 d.15.6.1 (B:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng

SCOP Domain Coordinates for d1jckb2:

Click to download the PDB-style file with coordinates for d1jckb2.
(The format of our PDB-style files is described here.)

Timeline for d1jckb2: