Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (14 PDB entries) |
Domain d2sebd2: 2seb D:122-236 [37781] Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd1 complexed with nag |
PDB Entry: 2seb (more details), 2.5 Å
SCOPe Domain Sequences for d2sebd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sebd2 d.15.6.1 (D:122-236) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
Timeline for d2sebd2:
View in 3D Domains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebb1, d2sebb2 |