Lineage for d2sebd2 (2seb D:122-236)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854470Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 854471Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 854493Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 854494Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)
  8. 854505Domain d2sebd2: 2seb D:122-236 [37781]
    Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd1
    complexed with nag

Details for d2sebd2

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
PDB Compounds: (D:) enterotoxin type b

SCOP Domain Sequences for d2sebd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sebd2 d.15.6.1 (D:122-236) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt

SCOP Domain Coordinates for d2sebd2:

Click to download the PDB-style file with coordinates for d2sebd2.
(The format of our PDB-style files is described here.)

Timeline for d2sebd2: