| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
| Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
| Domain d2sebd2: 2seb D:122-236 [37781] Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd1 complexed with nag |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2sebd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sebd2 d.15.6.1 (D:122-236) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
Timeline for d2sebd2:
View in 3DDomains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebb1, d2sebb2 |