Lineage for d2sebd2 (2seb D:122-236)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131210Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 131211Species Staphylococcus aureus [TaxId:1280] [54343] (11 PDB entries)
  8. 131222Domain d2sebd2: 2seb D:122-236 [37781]
    Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd1

Details for d2sebd2

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2sebd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sebd2 d.15.6.1 (D:122-236) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt

SCOP Domain Coordinates for d2sebd2:

Click to download the PDB-style file with coordinates for d2sebd2.
(The format of our PDB-style files is described here.)

Timeline for d2sebd2: