Lineage for d1sbbb2 (1sbb B:122-239)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403579Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 1403580Species Staphylococcus aureus [TaxId:1280] [54343] (14 PDB entries)
  8. 1403591Domain d1sbbb2: 1sbb B:122-239 [37779]
    Other proteins in same PDB: d1sbba1, d1sbba2, d1sbbb1, d1sbbc1, d1sbbc2, d1sbbd1

Details for d1sbbb2

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb
PDB Compounds: (B:) protein (staphylococcal enterotoxin b)

SCOPe Domain Sequences for d1sbbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbbb2 d.15.6.1 (B:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

SCOPe Domain Coordinates for d1sbbb2:

Click to download the PDB-style file with coordinates for d1sbbb2.
(The format of our PDB-style files is described here.)

Timeline for d1sbbb2: