Lineage for d1sbbb2 (1sbb B:122-239)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254376Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 254377Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)
  8. 254387Domain d1sbbb2: 1sbb B:122-239 [37779]
    Other proteins in same PDB: d1sbba1, d1sbba2, d1sbbb1, d1sbbc1, d1sbbc2, d1sbbd1

Details for d1sbbb2

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbbb2 d.15.6.1 (B:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

SCOP Domain Coordinates for d1sbbb2:

Click to download the PDB-style file with coordinates for d1sbbb2.
(The format of our PDB-style files is described here.)

Timeline for d1sbbb2: