![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
![]() | Domain d1sbbb2: 1sbb B:122-239 [37779] Other proteins in same PDB: d1sbba1, d1sbba2, d1sbbb1, d1sbbc1, d1sbbc2, d1sbbd1 |
PDB Entry: 1sbb (more details), 2.4 Å
SCOP Domain Sequences for d1sbbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbbb2 d.15.6.1 (B:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
Timeline for d1sbbb2: