Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) |
Domain d1se3a2: 1se3 A:122-239 [37778] Other proteins in same PDB: d1se3a1 |
PDB Entry: 1se3 (more details), 2.3 Å
SCOPe Domain Sequences for d1se3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se3a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
Timeline for d1se3a2: