Lineage for d1se3a2 (1se3 A:122-239)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1195886Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 1195887Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)
  8. 1195898Domain d1se3a2: 1se3 A:122-239 [37778]
    Other proteins in same PDB: d1se3a1

Details for d1se3a2

PDB Entry: 1se3 (more details), 2.3 Å

PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide
PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d1se3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se3a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

SCOPe Domain Coordinates for d1se3a2:

Click to download the PDB-style file with coordinates for d1se3a2.
(The format of our PDB-style files is described here.)

Timeline for d1se3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se3a1