Lineage for d1d6ec2 (1d6e C:122-237)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325777Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 325778Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)
  8. 325786Domain d1d6ec2: 1d6e C:122-237 [37777]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb1, d1d6eb2, d1d6ec1
    complexed with ace

Details for d1d6ec2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ec2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOP Domain Coordinates for d1d6ec2:

Click to download the PDB-style file with coordinates for d1d6ec2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ec2: