![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
![]() | Domain d1d6ec2: 1d6e C:122-237 [37777] Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb1, d1d6eb2, d1d6ec1 complexed with ace |
PDB Entry: 1d6e (more details), 2.45 Å
SCOP Domain Sequences for d1d6ec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ec2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
Timeline for d1d6ec2:
![]() Domains from other chains: (mouse over for more information) d1d6ea1, d1d6ea2, d1d6eb1, d1d6eb2 |