Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries) |
Domain d1se4a2: 1se4 A:122-239 [37776] Other proteins in same PDB: d1se4a1 complexed with lat |
PDB Entry: 1se4 (more details), 1.9 Å
SCOP Domain Sequences for d1se4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se4a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
Timeline for d1se4a2: