Lineage for d1se4_2 (1se4 122-239)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325777Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 325778Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)
  8. 325783Domain d1se4_2: 1se4 122-239 [37776]
    Other proteins in same PDB: d1se4_1
    complexed with lat

Details for d1se4_2

PDB Entry: 1se4 (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin b complexed with lactose

SCOP Domain Sequences for d1se4_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se4_2 d.15.6.1 (122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

SCOP Domain Coordinates for d1se4_2:

Click to download the PDB-style file with coordinates for d1se4_2.
(The format of our PDB-style files is described here.)

Timeline for d1se4_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se4_1