Lineage for d1d5zc2 (1d5z C:122-237)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403579Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 1403580Species Staphylococcus aureus [TaxId:1280] [54343] (14 PDB entries)
  8. 1403584Domain d1d5zc2: 1d5z C:122-237 [37775]
    Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc1

Details for d1d5zc2

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
PDB Compounds: (C:) protein (enterotoxin type b)

SCOPe Domain Sequences for d1d5zc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5zc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOPe Domain Coordinates for d1d5zc2:

Click to download the PDB-style file with coordinates for d1d5zc2.
(The format of our PDB-style files is described here.)

Timeline for d1d5zc2: