![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries) |
![]() | Domain d1d5zc2: 1d5z C:122-237 [37775] Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc1 |
PDB Entry: 1d5z (more details), 2 Å
SCOPe Domain Sequences for d1d5zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5zc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
Timeline for d1d5zc2:
![]() Domains from other chains: (mouse over for more information) d1d5za1, d1d5za2, d1d5zb1, d1d5zb2 |