SCOP 1.65: Domain d1d5mc2: 1d5m C:122-237

Lineage for d1d5mc2 (1d5m C:122-237)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)

8. Domain d1d5mc2: 1d5m C:122-237 [37774]
   Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1
   complexed with ace, nag

Details for d1d5mc2

PDB Entry: 1d5m, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5mc2:

Sequence; same for both SEQRES and ATOM records:

>d1d5mc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

Timeline for d1d5mc2:

• d1d5mc2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5mc2 appears in SCOP 1.63
  
• d1d5mc2 appears in SCOP 1.67
  
• d1d5mc2 appears in the current release, SCOPe 2.08