Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
Domain d1d5mc2: 1d5m C:122-237 [37774] Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1 complexed with ace, nag |
PDB Entry: 1d5m (more details), 2 Å
SCOP Domain Sequences for d1d5mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5mc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
Timeline for d1d5mc2:
View in 3D Domains from other chains: (mouse over for more information) d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2 |