Lineage for d1d5mc2 (1d5m C:122-237)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30645Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 30646Species Staphylococcus aureus [TaxId:1280] [54343] (10 PDB entries)
  8. Domain d1d5mc2: 1d5m C:122-237 [37774]
    Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1

Details for d1d5mc2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5mc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOP Domain Coordinates for d1d5mc2 are not available.

Timeline for d1d5mc2:

Domains from same chain:
(mouse over for more information)
d1d5mc1
Domains from other chains:
(mouse over for more information)
d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2