Lineage for d3seb_2 (3seb 122-238)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 499997Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 499998Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)
  8. 499999Domain d3seb_2: 3seb 122-238 [37773]
    Other proteins in same PDB: d3seb_1

Details for d3seb_2

PDB Entry: 3seb (more details), 1.48 Å

PDB Description: staphylococcal enterotoxin b

SCOP Domain Sequences for d3seb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3seb_2 d.15.6.1 (122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOP Domain Coordinates for d3seb_2:

Click to download the PDB-style file with coordinates for d3seb_2.
(The format of our PDB-style files is described here.)

Timeline for d3seb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3seb_1