Lineage for d1ts4b2 (1ts4 B:294-394)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78065Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 78066Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 78152Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 78153Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)
  8. 78180Domain d1ts4b2: 1ts4 B:294-394 [37772]
    Other proteins in same PDB: d1ts4a1, d1ts4b1

Details for d1ts4b2

PDB Entry: 1ts4 (more details), 3.4 Å

PDB Description: q139k mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts4b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltkihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d1ts4b2:

Click to download the PDB-style file with coordinates for d1ts4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ts4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ts4b1