Lineage for d1ts4a2 (1ts4 A:94-194)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1196013Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 1196014Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1196042Domain d1ts4a2: 1ts4 A:94-194 [37771]
    Other proteins in same PDB: d1ts4a1, d1ts4b1
    mutant

Details for d1ts4a2

PDB Entry: 1ts4 (more details), 3.4 Å

PDB Description: q139k mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts4a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltkihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d1ts4a2:

Click to download the PDB-style file with coordinates for d1ts4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ts4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ts4a1