Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) |
Domain d1ts4a2: 1ts4 A:94-194 [37771] Other proteins in same PDB: d1ts4a1, d1ts4b1 mutant |
PDB Entry: 1ts4 (more details), 3.4 Å
SCOPe Domain Sequences for d1ts4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts4a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltkihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1ts4a2: