SCOPe 2.08: Domain d6ktbb1: 6ktb B:1-62

Lineage for d6ktbb1 (6ktb B:1-62)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [377691] (4 PDB entries)

8. Domain d6ktbb1: 6ktb B:1-62 [377708]
   Other proteins in same PDB: d6ktba2, d6ktbb2
   automated match to d2ev0a1
   complexed with mg, mn, po4

Details for d6ktbb1

PDB Entry: 6ktb, 2.5 Å

PDB Description: crystal structure of b. halodurans mntr in apo form

PDB Compounds: (B:) HTH-type transcriptional regulator MntR

SCOPe Domain Sequences for d6ktbb1:

Sequence; same for both SEQRES and ATOM records:

>d6ktbb1 a.4.5.0 (B:1-62) automated matches {Bacillus halodurans [TaxId: 272558]}
mptpsmedyleriyllieekgyarvsdiaealevhpssvtkmvqkldksdylvyeryrgl
il

Timeline for d6ktbb1:

• d6ktbb1 first appeared in SCOPe 2.07