Lineage for d6kykc1 (6kyk C:1-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868635Domain d6kykc1: 6kyk C:1-167 [377706]
    Other proteins in same PDB: d6kykc2, d6kykd2, d6kyke2, d6kykf2
    automated match to d4hdob_
    complexed with gnp, mg; mutant

Details for d6kykc1

PDB Entry: 6kyk (more details), 2.82 Å

PDB Description: crystal structure of shank3 ntd-ank mutant in complex with rap1
PDB Compounds: (C:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d6kykc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kykc1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d6kykc1:

Click to download the PDB-style file with coordinates for d6kykc1.
(The format of our PDB-style files is described here.)

Timeline for d6kykc1: