Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
Domain d6kykc1: 6kyk C:1-167 [377706] Other proteins in same PDB: d6kykc2, d6kykd2, d6kyke2, d6kykf2 automated match to d4hdob_ complexed with gnp, mg; mutant |
PDB Entry: 6kyk (more details), 2.82 Å
SCOPe Domain Sequences for d6kykc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kykc1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
Timeline for d6kykc1: