| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
| Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries) |
| Domain d4tss_2: 4tss 94-194 [37770] Other proteins in same PDB: d4tss_1 |
PDB Entry: 4tss (more details), 2.75 Å
SCOP Domain Sequences for d4tss_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tss_2 d.15.6.1 (94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d4tss_2: