SCOPe 2.05: Domain d1ts5b2: 1ts5 B:294-394

Lineage for d1ts5b2 (1ts5 B:294-394)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)

8. Domain d1ts5b2: 1ts5 B:294-394 [37769]
   Other proteins in same PDB: d1ts5a1, d1ts5b1
   mutant

Details for d1ts5b2

PDB Entry: 1ts5, 3.1 Å

PDB Description: i140t mutant of toxic shock syndrome toxin-1 from s. aureus

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts5b2:

Sequence; same for both SEQRES and ATOM records:

>d1ts5b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqthglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d1ts5b2:

• d1ts5b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ts5b2 appears in SCOPe 2.04
  
• d1ts5b2 appears in SCOPe 2.06
  
• d1ts5b2 appears in the current release, SCOPe 2.08