Lineage for d1ts5a2 (1ts5 A:94-194)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894690Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 1894691Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1894716Domain d1ts5a2: 1ts5 A:94-194 [37768]
    Other proteins in same PDB: d1ts5a1, d1ts5b1
    mutant

Details for d1ts5a2

PDB Entry: 1ts5 (more details), 3.1 Å

PDB Description: i140t mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts5a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqthglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d1ts5a2:

Click to download the PDB-style file with coordinates for d1ts5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ts5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ts5a1