SCOP 1.57: Domain d1ts2c2: 1ts2 C:494-594

Lineage for d1ts2c2 (1ts2 C:494-594)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)

8. Domain d1ts2c2: 1ts2 C:494-594 [37765]
   Other proteins in same PDB: d1ts2a1, d1ts2b1, d1ts2c1

Details for d1ts2c2

PDB Entry: 1ts2, 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts2c2:

Sequence; same for both SEQRES and ATOM records:

>d1ts2c2 d.15.6.1 (C:494-594) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaisaldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d1ts2c2:

• d1ts2c2 first appeared (with stable ids) in SCOP 1.55
  
• d1ts2c2 appears in SCOP 1.59
  
• d1ts2c2 appears in the current release, SCOPe 2.08