Lineage for d6hera_ (6her A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928755Protein automated matches [191016] (9 species)
    not a true protein
  7. 2928777Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)
  8. 2928778Domain d6hera_: 6her A: [377637]
    Other proteins in same PDB: d6herb1, d6herb2
    automated match to d1i4ma_
    complexed with gol, so4

Details for d6hera_

PDB Entry: 6her (more details), 1.2 Å

PDB Description: mouse prion protein in complex with nanobody 484
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d6hera_:

Sequence, based on SEQRES records: (download)

>d6hera_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
agavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvh
dcvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyd

Sequence, based on observed residues (ATOM records): (download)

>d6hera_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
agavvgglggymgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
cvnitikqhtvtnftetdvkmmervveqmcvtqyqkesqayyd

SCOPe Domain Coordinates for d6hera_:

Click to download the PDB-style file with coordinates for d6hera_.
(The format of our PDB-style files is described here.)

Timeline for d6hera_: