Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries) |
Domain d6hera_: 6her A: [377637] Other proteins in same PDB: d6herb1, d6herb2 automated match to d1i4ma_ complexed with gol, so4 |
PDB Entry: 6her (more details), 1.2 Å
SCOPe Domain Sequences for d6hera_:
Sequence, based on SEQRES records: (download)
>d6hera_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} agavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvh dcvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyd
>d6hera_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} agavvgglggymgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd cvnitikqhtvtnftetdvkmmervveqmcvtqyqkesqayyd
Timeline for d6hera_: