SCOPe 2.08: Domain d6herb1: 6her B:6-124

Lineage for d6herb1 (6her B:6-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d6herb1: 6her B:6-124 [377636]
   Other proteins in same PDB: d6hera_, d6herb2
   automated match to d5da4a_
   complexed with gol, so4

Details for d6herb1

PDB Entry: 6her, 1.2 Å

PDB Description: mouse prion protein in complex with nanobody 484

PDB Compounds: (B:) Nanobody 484

SCOPe Domain Sequences for d6herb1:

Sequence; same for both SEQRES and ATOM records:

>d6herb1 b.1.1.1 (B:6-124) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdytdsvk
grftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqvtvss

Timeline for d6herb1:

• d6herb1 first appeared in SCOPe 2.07