Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) |
Domain d1ts2a2: 1ts2 A:94-194 [37763] Other proteins in same PDB: d1ts2a1, d1ts2b1, d1ts2c1 mutant |
PDB Entry: 1ts2 (more details), 2.3 Å
SCOPe Domain Sequences for d1ts2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts2a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkywpkfdkkqlaisaldfeirhqltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1ts2a2:
View in 3D Domains from other chains: (mouse over for more information) d1ts2b1, d1ts2b2, d1ts2c1, d1ts2c2 |