SCOPe 2.08: Domain d6q9na2: 6q9n A:139-327

Lineage for d6q9na2 (6q9n A:139-327)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256156] (6 PDB entries)

8. Domain d6q9na2: 6q9n A:139-327 [377595]
   Other proteins in same PDB: d6q9na1, d6q9na3, d6q9nb1, d6q9nb3
   automated match to d1vqqa2
   complexed with cd, cl, jpp, mur, qln

Details for d6q9na2

PDB Entry: 6q9n, 2.5 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with piperacillin and quinazolinone

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d6q9na2:

Sequence; same for both SEQRES and ATOM records:

>d6q9na2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d6q9na2:

• d6q9na2 first appeared in SCOPe 2.07