![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
![]() | Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) |
![]() | Domain d1ts3c2: 1ts3 C:494-594 [37759] Other proteins in same PDB: d1ts3a1, d1ts3b1, d1ts3c1 mutant |
PDB Entry: 1ts3 (more details), 2 Å
SCOPe Domain Sequences for d1ts3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts3c2 d.15.6.1 (C:494-594) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeiraqltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1ts3c2:
![]() Domains from other chains: (mouse over for more information) d1ts3a1, d1ts3a2, d1ts3b1, d1ts3b2 |