SCOPe 2.06: Domain d1ts3b2: 1ts3 B:294-394

Lineage for d1ts3b2 (1ts3 B:294-394)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)

8. Domain d1ts3b2: 1ts3 B:294-394 [37758]
   Other proteins in same PDB: d1ts3a1, d1ts3b1, d1ts3c1
   mutant

Details for d1ts3b2

PDB Entry: 1ts3, 2 Å

PDB Description: h135a mutant of toxic shock syndrome toxin-1 from s. aureus

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts3b2:

Sequence; same for both SEQRES and ATOM records:

>d1ts3b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeiraqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d1ts3b2:

• d1ts3b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ts3b2 appears in SCOPe 2.05
  
• d1ts3b2 appears in SCOPe 2.07
  
• d1ts3b2 appears in the current release, SCOPe 2.08