Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries) |
Domain d1ts3b2: 1ts3 B:294-394 [37758] Other proteins in same PDB: d1ts3a1, d1ts3b1, d1ts3c1 |
PDB Entry: 1ts3 (more details), 2 Å
SCOP Domain Sequences for d1ts3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts3b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeiraqltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1ts3b2:
View in 3D Domains from other chains: (mouse over for more information) d1ts3a1, d1ts3a2, d1ts3c1, d1ts3c2 |