Lineage for d6pw0c_ (6pw0 C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632460Species Rhodobacter sphaeroides [TaxId:272943] [189626] (6 PDB entries)
  8. 2632470Domain d6pw0c_: 6pw0 C: [377565]
    Other proteins in same PDB: d6pw0b1, d6pw0b2, d6pw0b3, d6pw0d1, d6pw0d2, d6pw0d3
    automated match to d1m56a_
    complexed with ca, cd, cu, dmu, hea, hth, mal, mg, oh, trd, trs; mutant

Details for d6pw0c_

PDB Entry: 6pw0 (more details), 2.5 Å

PDB Description: cytochrome c oxidase delta 6 mutant
PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d6pw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pw0c_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d6pw0c_:

Click to download the PDB-style file with coordinates for d6pw0c_.
(The format of our PDB-style files is described here.)

Timeline for d6pw0c_: