Lineage for d1aw7b2 (1aw7 B:294-394)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639379Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 1639380Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1639386Domain d1aw7b2: 1aw7 B:294-394 [37754]
    Other proteins in same PDB: d1aw7a1, d1aw7b1, d1aw7c1, d1aw7d1
    mutant

Details for d1aw7b2

PDB Entry: 1aw7 (more details), 1.95 Å

PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1aw7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw7b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhaltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d1aw7b2:

Click to download the PDB-style file with coordinates for d1aw7b2.
(The format of our PDB-style files is described here.)

Timeline for d1aw7b2: