Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) |
Domain d1aw7b2: 1aw7 B:294-394 [37754] Other proteins in same PDB: d1aw7a1, d1aw7b1, d1aw7c1, d1aw7d1 mutant |
PDB Entry: 1aw7 (more details), 1.95 Å
SCOPe Domain Sequences for d1aw7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw7b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhaltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1aw7b2: