Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein automated matches [233090] (1 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries) |
Domain d6pw0d1: 6pw0 D:30-129 [377519] Other proteins in same PDB: d6pw0a_, d6pw0b2, d6pw0b3, d6pw0c_, d6pw0d2, d6pw0d3 automated match to d3fyeb1 complexed with ca, cd, cu, dmu, hea, hth, mg, oh, trd, trs; mutant |
PDB Entry: 6pw0 (more details), 2.5 Å
SCOPe Domain Sequences for d6pw0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pw0d1 f.17.2.1 (D:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d6pw0d1: