Lineage for d6pw1d1 (6pw1 D:30-129)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629576Protein automated matches [233090] (1 species)
    not a true protein
  7. 2629577Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries)
  8. 2629579Domain d6pw1d1: 6pw1 D:30-129 [377516]
    Other proteins in same PDB: d6pw1a_, d6pw1b2, d6pw1b3, d6pw1c_, d6pw1d2, d6pw1d3
    automated match to d3fyeb1
    complexed with ca, cd, cu, dmu, hea, hth, mal, mg, trd, trs

Details for d6pw1d1

PDB Entry: 6pw1 (more details), 2.1 Å

PDB Description: cytochrome c oxidase delta 16
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6pw1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pw1d1 f.17.2.1 (D:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d6pw1d1:

Click to download the PDB-style file with coordinates for d6pw1d1.
(The format of our PDB-style files is described here.)

Timeline for d6pw1d1: