Lineage for d2tssa2 (2tss A:94-194)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403724Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 1403725Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1403727Domain d2tssa2: 2tss A:94-194 [37750]
    Other proteins in same PDB: d2tssa1, d2tssb1, d2tssc1

Details for d2tssa2

PDB Entry: 2tss (more details), 2.05 Å

PDB Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d2tssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tssa2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d2tssa2:

Click to download the PDB-style file with coordinates for d2tssa2.
(The format of our PDB-style files is described here.)

Timeline for d2tssa2: