SCOP 1.67: Domain d2tssa2: 2tss A:94-194

Lineage for d2tssa2 (2tss A:94-194)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)

8. Domain d2tssa2: 2tss A:94-194 [37750]
   Other proteins in same PDB: d2tssa1, d2tssb1, d2tssc1

Details for d2tssa2

PDB Entry: 2tss, 2.05 Å

PDB Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form

SCOP Domain Sequences for d2tssa2:

Sequence; same for both SEQRES and ATOM records:

>d2tssa2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d2tssa2:

• d2tssa2 first appeared (with stable ids) in SCOP 1.55
  
• d2tssa2 appears in SCOP 1.65
  
• d2tssa2 appears in SCOP 1.69
  
• d2tssa2 appears in the current release, SCOPe 2.08