Lineage for d3tssa2 (3tss A:94-194)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639379Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 1639380Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1639381Domain d3tssa2: 3tss A:94-194 [37749]
    Other proteins in same PDB: d3tssa1
    mutant

Details for d3tssa2

PDB Entry: 3tss (more details), 1.9 Å

PDB Description: toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d3tssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tssa2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfkirhqltqthglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d3tssa2:

Click to download the PDB-style file with coordinates for d3tssa2.
(The format of our PDB-style files is described here.)

Timeline for d3tssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tssa1