Lineage for d1se2_2 (1se2 121-239)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131226Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)
  7. 131227Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries)
  8. 131234Domain d1se2_2: 1se2 121-239 [37745]
    Other proteins in same PDB: d1se2_1

Details for d1se2_2

PDB Entry: 1se2 (more details), 2.7 Å

PDB Description: staphylococcal enterotoxin c2, monoclinic form

SCOP Domain Sequences for d1se2_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se2_2 d.15.6.1 (121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1se2_2:

Click to download the PDB-style file with coordinates for d1se2_2.
(The format of our PDB-style files is described here.)

Timeline for d1se2_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se2_1