Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54339] (8 PDB entries) |
Domain d1stea2: 1ste A:121-238 [37743] Other proteins in same PDB: d1stea1 complexed with zn |
PDB Entry: 1ste (more details), 2 Å
SCOPe Domain Sequences for d1stea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stea2 d.15.6.1 (A:121-238) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]} nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn
Timeline for d1stea2: