Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54337] (5 PDB entries) |
Domain d1i4ha2: 1i4h A:121-233 [37741] Other proteins in same PDB: d1i4ha1, d1i4hb1 |
PDB Entry: 1i4h (more details), 2.9 Å
SCOP Domain Sequences for d1i4ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ha2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1i4ha2: