Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries) |
Domain d1sxta2: 1sxt A:121-233 [37739] Other proteins in same PDB: d1sxta1, d1sxtb1 complexed with zn |
PDB Entry: 1sxt (more details), 2.7 Å
SCOPe Domain Sequences for d1sxta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxta2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1sxta2: