Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries) |
Domain d1i4gb2: 1i4g B:121-233 [37738] Other proteins in same PDB: d1i4ga1, d1i4gb1 complexed with so4, zn; mutant |
PDB Entry: 1i4g (more details), 2.1 Å
SCOPe Domain Sequences for d1i4gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4gb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1i4gb2: