![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54337] (5 PDB entries) |
![]() | Domain d1i4gb2: 1i4g B:121-233 [37738] Other proteins in same PDB: d1i4ga1, d1i4gb1 |
PDB Entry: 1i4g (more details), 2.1 Å
SCOP Domain Sequences for d1i4gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4gb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1i4gb2: