Lineage for d1i4gb2 (1i4g B:121-233)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30635Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 30636Species Staphylococcus aureus [TaxId:1280] [54337] (4 PDB entries)
  8. Domain d1i4gb2: 1i4g B:121-233 [37738]
    Other proteins in same PDB: d1i4ga1, d1i4gb1

Details for d1i4gb2

PDB Entry: 1i4g (more details), 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

SCOP Domain Sequences for d1i4gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4gb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1i4gb2 are not available.

Timeline for d1i4gb2:

Domains from same chain:
(mouse over for more information)
d1i4gb1
Domains from other chains:
(mouse over for more information)
d1i4ga1, d1i4ga2