SCOP 1.61: Domain d1esfb2: 1esf B:121-233

Lineage for d1esfb2 (1esf B:121-233)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (5 PDB entries)

8. Domain d1esfb2: 1esf B:121-233 [37736]
   Other proteins in same PDB: d1esfa1, d1esfb1

Details for d1esfb2

PDB Entry: 1esf, 1.9 Å

PDB Description: staphylococcal enterotoxin a

SCOP Domain Sequences for d1esfb2:

Sequence; same for both SEQRES and ATOM records:

>d1esfb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1esfb2:

• d1esfb2 first appeared (with stable ids) in SCOP 1.55
  
• d1esfb2 appears in SCOP 1.59
  
• d1esfb2 appears in SCOP 1.63
  
• d1esfb2 appears in the current release, SCOPe 2.08