SCOP 1.71: Domain d1esfa2: 1esf A:121-233

Lineage for d1esfa2 (1esf A:121-233)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)

8. Domain d1esfa2: 1esf A:121-233 [37735]
   Other proteins in same PDB: d1esfa1, d1esfb1

Details for d1esfa2

PDB Entry: 1esf, 1.9 Å

PDB Description: staphylococcal enterotoxin a

SCOP Domain Sequences for d1esfa2:

Sequence; same for both SEQRES and ATOM records:

>d1esfa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1esfa2:

• d1esfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1esfa2 appears in SCOP 1.69
  
• d1esfa2 appears in SCOP 1.73
  
• d1esfa2 appears in the current release, SCOPe 2.08