Lineage for d6icyb_ (6icy B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041095Domain d6icyb_: 6icy B: [377247]
    Other proteins in same PDB: d6icya_
    automated match to d4d00d_
    complexed with nag; mutant

Details for d6icyb_

PDB Entry: 6icy (more details), 2.4 Å

PDB Description: crystal structure of h7 hemagglutinin mutant h7-agtl ( v186g, p221t) from the influenza virus a/anhui/1/2013 (h7n9)
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6icyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6icyb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

SCOPe Domain Coordinates for d6icyb_:

Click to download the PDB-style file with coordinates for d6icyb_.
(The format of our PDB-style files is described here.)

Timeline for d6icyb_: